PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02443.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 233aa    MW: 26985.4 Da    PI: 9.1388
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02443.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.61.2e-171057148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ed llv+ v+++G ++W+ +a+  g++Rt+k+c++rw +yl
  Rsa1.0_02443.1_g00005.1 10 KGPWTEQEDILLVNFVHMFGDRRWDFVAKVSGLNRTGKSCRLRWVNYL 57
                             79********************************************97 PP

2Myb_DNA-binding57.14.2e-1863108148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
  Rsa1.0_02443.1_g00005.1  63 RGKMTPDEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 108
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.744157IPR017930Myb domain
SuperFamilySSF466893.16E-308104IPR009057Homeodomain-like
SMARTSM007171.8E-15959IPR001005SANT/Myb domain
PfamPF002491.2E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-211164IPR009057Homeodomain-like
CDDcd001678.88E-111257No hitNo description
PROSITE profilePS5129428.0658112IPR017930Myb domain
SMARTSM007171.8E-1762110IPR001005SANT/Myb domain
PfamPF002491.8E-1663107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2465111IPR009057Homeodomain-like
CDDcd001672.20E-1265108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MKNVQAEYRK GPWTEQEDIL LVNFVHMFGD RRWDFVAKVS GLNRTGKSCR LRWVNYLHPG  60
LKRGKMTPDE ERLVLELHAK WGNRWSKIAR KLPGRTDNEI KNYWRTHMRK KAQEKKRPMS  120
PASSSSNFCS SSMTTATTQD TGGSKGKMNQ ECEDRYYSMD DIWREIDQSG ESITKPAEQS  180
CYLNFPPLAS PAWESSLESI WNIDADESKM SSFAIDQFPL TFEHGRSSWS SLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-2871121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0628940.0AF062894.1 Arabidopsis thaliana putative transcription factor (MYB59) mRNA, complete cds.
GenBankAY5196410.0AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618694.11e-158PREDICTED: transcription factor MYB59 isoform X3
SwissprotQ4JL841e-146MYB59_ARATH; Transcription factor MYB59
TrEMBLA0A0D3AKW51e-158A0A0D3AKW5_BRAOL; Uncharacterized protein
STRINGBra020289.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25022774
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.31e-144myb domain protein 59